science.pdb.sequence
Search protein structures by amino acid sequence similarity using BLAST. Input a protein sequence to find matching PDB structures with configurable identity and E-value thresholds for homology modeling and structure prediction.
Instructions
Search protein structures by amino acid sequence similarity (BLAST). Input a protein sequence and find all PDB structures with matching chains. Configure identity cutoff (e.g. 90%) and E-value threshold. Returns PDB entity IDs ranked by similarity score. Essential for homology modeling and structure prediction (RCSB PDB)
Input Schema
TableJSON Schema
| Name | Required | Description | Default |
|---|---|---|---|
| sequence | Yes | Protein amino acid sequence in one-letter code (e.g. "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" — first 50 residues of human hemoglobin alpha) | |
| identity_cutoff | No | Minimum sequence identity (0.1-1.0). Default: 0.9 (90% identical) | |
| evalue_cutoff | No | Maximum E-value threshold for BLAST significance. Default: 0.1 | |
| limit | No | Maximum number of results (1-50). Default: 10 |