Skip to main content
Glama

science.pdb.sequence

Search protein structures by amino acid sequence similarity using BLAST. Input a protein sequence to find matching PDB structures with configurable identity and E-value thresholds for homology modeling and structure prediction.

Instructions

Search protein structures by amino acid sequence similarity (BLAST). Input a protein sequence and find all PDB structures with matching chains. Configure identity cutoff (e.g. 90%) and E-value threshold. Returns PDB entity IDs ranked by similarity score. Essential for homology modeling and structure prediction (RCSB PDB)

Input Schema

TableJSON Schema
NameRequiredDescriptionDefault
sequenceYesProtein amino acid sequence in one-letter code (e.g. "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" — first 50 residues of human hemoglobin alpha)
identity_cutoffNoMinimum sequence identity (0.1-1.0). Default: 0.9 (90% identical)
evalue_cutoffNoMaximum E-value threshold for BLAST significance. Default: 0.1
limitNoMaximum number of results (1-50). Default: 10
Install Server

Other Tools

Latest Blog Posts

MCP directory API

We provide all the information about MCP servers via our MCP API.

curl -X GET 'https://glama.ai/api/mcp/v1/servers/whiteknightonhorse/APIbase'

If you have feedback or need assistance with the MCP directory API, please join our Discord server