peptoma-mcp
OfficialClick on "Install Server".
Wait a few minutes for the server to deploy. Once ready, it will show a "Started" state.
In the chat, type
@followed by the MCP server name and your instructions, e.g., "@peptoma-mcpanalyze peptide sequence ACDEFGHIKL"
That's it! The server will respond to your query, and you can continue using it as needed.
Here is a step-by-step guide with screenshots.
peptoma-mcp
Official MCP (Model Context Protocol) server for PEPTOMA — connect any AI agent to the open DeSci peptide research platform.
What This Does
peptoma-mcp runs a local MCP server that exposes PEPTOMA's full research platform as tools to any compatible AI agent — Claude Desktop, Cursor, VS Code, Zed, and any other MCP-compatible client.
Once connected, your AI agent can:
Submit peptide sequences for AI analysis and receive bioactivity scores, structure predictions, toxicity risk, and half-life estimates
Search and filter the open PEPTOMA research feed of thousands of analyzed sequences
Read and write peer-review annotations to earn $PEPTM token rewards
Query token balances, staking tiers, and the contributor leaderboard
No custom code required. Install, configure, and your agent is connected to the live PEPTOMA platform.
Requirements
Node.js ≥ 18
A PEPTOMA API key (
pptm_...) — available to PRO (≥ 2,000 $PEPTM staked) and LAB (≥ 10,000 $PEPTM staked) tier walletsGenerate your key at peptoma.xyz/missions
Quick Start
# Run directly with npx (no install needed)
npx peptoma-mcp --api-key pptm_your_key_here
# Or install globally
npm install -g peptoma-mcp
peptoma-mcp --api-key pptm_your_key_here
# Or use environment variable
export PEPTOMA_API_KEY=pptm_your_key_here
npx peptoma-mcpClaude Desktop Setup
Add to ~/.claude/claude_desktop_config.json:
{
"mcpServers": {
"peptoma": {
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}Restart Claude Desktop. You will now see PEPTOMA tools available in your conversations.
Cursor Setup
Add to your Cursor MCP config (.cursor/mcp.json or global config):
{
"mcpServers": {
"peptoma": {
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}VS Code (Copilot Agent Mode)
Add to .vscode/mcp.json in your project:
{
"servers": {
"peptoma": {
"type": "stdio",
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}Available Tools
Once connected, these tools are available to your AI agent:
analyze_sequence
Submit a peptide sequence for analysis by the PEPTOMA AI Engine.
Inputs:
Parameter | Type | Required | Description |
| string | Yes | Single-letter amino acid code or FASTA format (3–512 residues) |
|
| No | Analysis depth (default: |
| string | No | Disease or organism context (e.g. |
| string | No | Solana wallet address for on-chain attribution |
| string | No | Research notes |
Returns: Full SequenceAnalysis object with bioactivity score, label, structure, toxicity, MW, hydrophobicity, charge, half-life, confidence, and annotation suggestions.
get_analysis
Retrieve a previous analysis by ID.
Inputs: id (number)
search_feed
Search the open PEPTOMA research feed.
Inputs:
Parameter | Type | Description |
| string | Filter by disease target |
| number | Minimum bioactivity score (0–100) |
|
| Sort order |
| number | Results per page (default: 20) |
| number | Page number (default: 1) |
get_feed_stats
Platform-wide statistics: total analyses, average scores, annotation counts, disease breakdown.
get_trending
Top 10 sequences ranked by community vote count.
list_annotations
List all peer-review annotations for a sequence.
Inputs: sequenceId (number)
create_annotation
Submit a peer-review annotation and earn $PEPTM.
Inputs:
Parameter | Type | Required | Description |
| number | Yes | Target sequence ID |
| string | Yes | Your wallet address (for token rewards) |
|
| Yes | Annotation type |
| string | No | Your scientific reasoning or evidence |
Reward rates: confirm +2, challenge +3, extend +5, tag +2 $PEPTM
vote_annotation
Upvote or downvote an annotation.
Inputs: annotationId (number), direction ("up" | "down")
get_token_balance
Get $PEPTM balance and staking info for a user.
Inputs: userId (string — Solana wallet address)
get_leaderboard
Top contributors ranked by total $PEPTM earned.
Example Agent Sessions
Screening antimicrobial candidates:
You: Screen these sequences for MRSA activity and flag anything above 80 with low toxicity:
KWLRRVWRPQKI, FLPLIGRVLSGIL, GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK
Agent:
→ analyze_sequence("KWLRRVWRPQKI", disease: "MRSA") → score: 91, toxic: low ✓
→ analyze_sequence("FLPLIGRVLSGIL", disease: "MRSA") → score: 67, toxic: medium ✗
→ analyze_sequence("GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK", disease: "MRSA") → score: 88, toxic: low ✓
2 candidates passed: #1 and #3. Submitting confirmation annotations...
→ create_annotation(sequenceId: 1, type: "confirm", content: "High AMP score, low toxicity...")
→ create_annotation(sequenceId: 3, type: "confirm", content: "Defensin-class AMP candidate...")Researching what's in the feed:
You: What are the top cancer peptides on PEPTOMA right now?
Agent:
→ search_feed({ disease: "Cancer", sort: "score", limit: 10 })
Returns ranked list with bioactivity scores, structure types, and annotation counts.Building a research report:
You: Give me a summary of the PEPTOMA platform activity today
Agent:
→ get_feed_stats() → totalAnalyses: 1,247, recentActivity: 34, avgScore: 71.4
→ get_trending() → top 10 sequences with community vote counts
→ get_leaderboard() → top 5 contributors this periodCLI Options
peptoma-mcp [options]
Options:
--api-key <key> Your PEPTOMA API key (pptm_...)
--base-url <url> Override API base URL (default: https://peptoma.xyz/api)
--help Show helpEnvironment Variables
Variable | Description |
| Your PEPTOMA API key — alternative to |
| Override API base URL |
Links
Resource | URL |
Platform | |
Docs | |
npm (SDK) | |
npm (MCP) | |
Token CA |
|
License
MIT © 2026 PEPTOMA Team
This server cannot be installed
Resources
Unclaimed servers have limited discoverability.
Looking for Admin?
If you are the server author, to access and configure the admin panel.
Latest Blog Posts
MCP directory API
We provide all the information about MCP servers via our MCP API.
curl -X GET 'https://glama.ai/api/mcp/v1/servers/peptoma/mcp'
If you have feedback or need assistance with the MCP directory API, please join our Discord server